PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10031793m
Common NameCICLE_v10031793mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 388aa    MW: 42924.4 Da    PI: 7.4804
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10031793mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32217272156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r+ W+peLH+rF++a++qLGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Ciclev10031793m 217 KQRRSWSPELHRRFLHALQQLGGSHAATPKQIRELMNVDGLTNDEVKSHLQKYRLH 272
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.438214274IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-28215275IPR009057Homeodomain-like
SuperFamilySSF466891.97E-18215275IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-27217272IPR006447Myb domain, plants
PfamPF002493.9E-8219270IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MDYAEKMQRC HEYVEALEEE KRKIQVFQRE LPLCLELVTQ AIQACRRELS GTTTEYMHVQ  60
SECSEQTSSD GPILEEFIPI KRSSSHDDND NDNDDRHSNR PTTTNNNREK EKNSDKKKSD  120
WLRSVQLWNQ SPDPQPKEEE VVPRKATVVE VKRNGSGGAF QPFHREKCGE KKDQQQRLGK  180
VNTPVPTAAA SSTTDTAVGK GEKNDKDKDK EGQPQRKQRR SWSPELHRRF LHALQQLGGS  240
HAATPKQIRE LMNVDGLTND EVKSHLQKYR LHTRRPSPAM HNGGNPQAPQ FVVVGGIWVQ  300
APEYAAVAAK APGEAGSIAT SNGIYAPVAA PPPAVPQSSA SVVQISQQTQ SEHLQSEERG  360
SHSDGGHHAN SPATSSSTHT TTTSPVF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.7570.0flower| fruit| vegetative tissue
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437730.10.0hypothetical protein CICLE_v10031793mg
TrEMBLV4TH640.0V4TH64_9R
STRINGVIT_01s0011g03110.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-94G2-like family protein